RetrogeneDB ID: | retro_pabe_1416 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 16_random:646456..646804(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL18 | ||
Ensembl ID: | ENSPPYG00000017147 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L18 [Source:HGNC Symbol;Acc:14477] |
Percent Identity: | 55.74 % |
Parental protein coverage: | 66.11 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | ARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIK-KHLYSTRNVVACESIGR |
A....G......S.EFWH...V.RTQ.H..ALVEH.NG..V.SAST.E..IK..H..ST.NV...E.IG. | |
Retrocopy | ATEKQGSAPHLSSSEFWHGW*VPRTQQH-KALVEHPNGQGVISASTYECTIK<MHRSSTKNVTG-ENIGQ |
Parental | VLAQ-RCLEAGINFMVYQPTPWEAA-SDSMKRLRSAMTEGGVVLREPQRIYE |
.LA....L.AGINF.VYQ..PWEAA..DSM.RLRSA.T.GGV..REP.R..E | |
Retrocopy | LLAK<ARLKAGINFTVYQADPWEAA<LDSMRRLRSAKTGGGVAPREPRRTCE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .05 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .46 RPM |
SRP007412_heart | 0 .00 RPM | 13 .49 RPM |
SRP007412_kidney | 0 .00 RPM | 26 .35 RPM |
SRP007412_liver | 0 .00 RPM | 20 .50 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015398 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011514 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007591 | 1 retrocopy | |
Homo sapiens | ENSG00000112110 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000014075 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017037 | 1 retrocopy | |
Mus musculus | ENSMUSG00000057388 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007327 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017147 | 3 retrocopies |
retro_pabe_1416 , retro_pabe_1418, retro_pabe_1421,
|
Pan troglodytes | ENSPTRG00000018761 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000005322 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005598 | 1 retrocopy |