RetrogeneDB ID: | retro_ptro_1128 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 16:11549846..11550195(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL18 | ||
Ensembl ID: | ENSPTRG00000018761 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.72 % |
Parental protein coverage: | 66.11 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | ARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIK-KHLYSTRNVVACESIGR |
A....G..T...S.EF.H...V.RTQ....ALVEH.NG.VV.SAS..E..IK.KH..ST.NV...E.IG. | |
Retrocopy | AAEKQGSATHLSSSEFRHGW*VPRTQQR-KALVEHPNGQVVISASSYECTIK<KHRSSTKNVTG-ENIGQ |
Parental | VLAQ-RCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE |
.LA....L.AGINFMVYQP.PWEAA.D.M..L.SA...G.V...EP.RI.E | |
Retrocopy | LLAE<ARLKAGINFMVYQPDPWEAALDLMRQL*SAKMGGAVAPQEPRRICE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 20 .97 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .82 RPM |
SRP007412_heart | 0 .00 RPM | 15 .59 RPM |
SRP007412_kidney | 0 .00 RPM | 24 .61 RPM |
SRP007412_liver | 0 .00 RPM | 26 .97 RPM |
SRP007412_testis | 0 .21 RPM | 22 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1664 |
Gorilla gorilla | retro_ggor_1255 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015398 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011514 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007591 | 1 retrocopy | |
Homo sapiens | ENSG00000112110 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000014075 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017037 | 1 retrocopy | |
Mus musculus | ENSMUSG00000057388 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007327 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017147 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000018761 | 1 retrocopy |
retro_ptro_1128 ,
|
Pteropus vampyrus | ENSPVAG00000005322 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005598 | 1 retrocopy |