RetrogeneDB ID: | retro_pabe_213 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:5596981..5597201(+) | ||
Located in intron of: | ENSPPYG00000000060 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP7 | ||
Ensembl ID: | ENSPPYG00000016979 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 7, brain [Source:HGNC Symbol;Acc:3562] |
Percent Identity: | 74.32 % |
Parental protein coverage: | 55.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | NTEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF-GDVVAVRH |
NT..SFHLGEEFDET..DDRNCK.VVSLD.DKL.HIQKWD.KET.F.REIK.G.MVMT.....DVVAV.H | |
Retrocopy | NTVVSFHLGEEFDETATDDRNCKFVVSLDRDKLIHIQKWDDKETYFIREIKYGEMVMTYFW>DDVVAVHH |
Parental | YEKA |
Y.KA | |
Retrocopy | YKKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 10 .51 RPM |
SRP007412_cerebellum | 0 .36 RPM | 46 .82 RPM |
SRP007412_heart | 0 .00 RPM | 0 .12 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .27 RPM |
SRP007412_liver | 0 .00 RPM | 0 .06 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_536 |
Pan troglodytes | retro_ptro_402 |
Gorilla gorilla | retro_ggor_489 |
Macaca mulatta | retro_mmul_458 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
Homo sapiens | ENSG00000164434 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016979 | 1 retrocopy |
retro_pabe_213 ,
|
Pongo abelii | ENSPPYG00000018699 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |