RetrogeneDB ID: | retro_ogar_2821 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873667.1:3200991..3201211(-) | ||
Located in intron of: | ENSOGAG00000001296 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP7 | ||
Ensembl ID: | ENSOGAG00000031110 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 7, brain [Source:HGNC Symbol;Acc:3562] |
Percent Identity: | 67.57 % |
Parental protein coverage: | 55.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KNTEISFHLGEEFDETTADDRNCKSV-VSLDGDKLVHVQKWDGKETNFVREIKDGKMVMTLTFGDVVAVR |
K....SF..GEEFDE.TADDRNCKSV..........HV.K.DG.ETNFVREIKDG.MVMTL.FG.VVAV. | |
Retrocopy | KIAQNSFQMGEEFDESTADDRNCKSV>AWMETNLFIHV*KQDGQETNFVREIKDGNMVMTLSFGHVVAVC |
Parental | HYEK |
HYEK | |
Retrocopy | HYEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
Homo sapiens | ENSG00000164434 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000002413 | 10 retrocopies | |
Otolemur garnettii | ENSOGAG00000012166 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy |
retro_ogar_2821 ,
|
Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |