RetrogeneDB ID: | retro_pabe_2717 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 5:14353241..14353589(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NENF | ||
Ensembl ID: | ENSPPYG00000000236 | ||
Aliases: | None | ||
Description: | neudesin neurotrophic factor [Source:HGNC Symbol;Acc:30384] |
Percent Identity: | 62.71 % |
Parental protein coverage: | 66.86 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | EEEDQPIYLAVKGVVFDVTSGKEFYGRGAP-YNALTGKDSTRGVA-KMSLDPADLTHDTTGLTAKELEAL |
E..D...Y...K.VVF.VT.GK.F.GRGAP.YNALT.K.ST...A.K..L.PA.LTHD.TG..A.ELE.. | |
Retrocopy | EQNDHHSYISTKDVVFAVTLGKGFQGRGAP>YNALTWKTSTTRIA>KKCLVPAKLTHDSTGY*AEELESS |
Parental | -DEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF |
.DEVFTK.YKAKYPIV.YTA.RILNE..S...D.K...Q.HFDIKDEF | |
Retrocopy | >DEVFTKMYKAKYPIVKYTAQRILNENRSSSMDLKQKAQTHFDIKDEF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 1 .05 RPM | 18 .96 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .21 RPM |
SRP007412_heart | 0 .00 RPM | 11 .23 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .37 RPM |
SRP007412_liver | 0 .00 RPM | 11 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3288 |
Pan troglodytes | retro_ptro_2224 |
Macaca mulatta | retro_mmul_2064 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
Bos taurus | ENSBTAG00000000759 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy | |
Felis catus | ENSFCAG00000031796 | 1 retrocopy | |
Homo sapiens | ENSG00000117691 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies | |
Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000236 | 2 retrocopies |
retro_pabe_2717 , retro_pabe_328,
|
Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |