RetrogeneDB ID: | retro_pabe_3495 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 9:90149854..90150299(-) | ||
Located in intron of: | ENSPPYG00000019399 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YRDC | ||
Ensembl ID: | ENSPPYG00000001523 | ||
Aliases: | None | ||
Description: | yrdC domain containing (E. coli) [Source:HGNC Symbol;Acc:28905] |
Percent Identity: | 77.85 % |
Parental protein coverage: | 60.66 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | CRVRVPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLV-GIRIPDHAFMQDLAQMFEGPLALTSANLSS |
C...VP..LL.DL.P.PV.LVMERSEELN.DLNPFTPL..GIRIPD.AFMQDLA.M.E.PLALTSANLSS | |
Retrocopy | CMRVVPQELLQDLVPVPVSLVMERSEELNNDLNPFTPLI>GIRIPDYAFMQDLAKMYEHPLALTSANLSS |
Parental | QASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYG |
Q.SSLNV.E..DLWPQLSLVI.GGQ..D.Q.PEC.LGSTVVDLSV..KFGIIRPGCALESTTA.LQQ.YG | |
Retrocopy | QDSSLNVMEL*DLWPQLSLVIEGGQTRDSQIPECCLGSTVVDLSVHRKFGIIRPGCALESTTAFLQQRYG |
Parental | LLPSHVSYL |
L.PS..SYL | |
Retrocopy | LHPSRASYL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 5 .75 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .44 RPM |
SRP007412_heart | 0 .00 RPM | 1 .54 RPM |
SRP007412_kidney | 0 .03 RPM | 4 .51 RPM |
SRP007412_liver | 0 .00 RPM | 4 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4289 |
Macaca mulatta | retro_mmul_1206 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001173 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009111 | 2 retrocopies | |
Equus caballus | ENSECAG00000022522 | 1 retrocopy | |
Felis catus | ENSFCAG00000011018 | 1 retrocopy | |
Homo sapiens | ENSG00000196449 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007619 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000005068 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011953 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000955 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005372 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000011665 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000030474 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001523 | 1 retrocopy |
retro_pabe_3495 ,
|
Pan troglodytes | ENSPTRG00000000557 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000008863 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005555 | 3 retrocopies |