RetrogeneDB ID: | retro_pabe_3825 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | X:154966892..154967105(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN1 | ||
| Ensembl ID: | ENSPPYG00000011426 | ||
| Aliases: | None | ||
| Description: | high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984] |
| Percent Identity: | 91.55 % |
| Parental protein coverage: | 71.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET |
| MPKRKV.SA.GAAKEEPKR.SARLSAKPPAKVE.KPKKAAAKDKSSDKKV.TKGKR.AKGKQAEVANQET | |
| Retrocopy | MPKRKVGSAKGAAKEEPKRSSARLSAKPPAKVEVKPKKAAAKDKSSDKKVPTKGKRRAKGKQAEVANQET |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 44 .75 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .33 RPM |
| SRP007412_kidney | 0 .00 RPM | 76 .60 RPM |
| SRP007412_liver | 0 .03 RPM | 35 .83 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_3278 |
| Gorilla gorilla | retro_ggor_48 |