RetrogeneDB ID: | retro_pabe_3825 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:154966892..154967105(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN1 | ||
Ensembl ID: | ENSPPYG00000011426 | ||
Aliases: | None | ||
Description: | high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984] |
Percent Identity: | 91.55 % |
Parental protein coverage: | 71. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET |
MPKRKV.SA.GAAKEEPKR.SARLSAKPPAKVE.KPKKAAAKDKSSDKKV.TKGKR.AKGKQAEVANQET | |
Retrocopy | MPKRKVGSAKGAAKEEPKRSSARLSAKPPAKVEVKPKKAAAKDKSSDKKVPTKGKRRAKGKQAEVANQET |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .67 RPM |
SRP007412_cerebellum | 0 .00 RPM | 44 .75 RPM |
SRP007412_heart | 0 .00 RPM | 14 .33 RPM |
SRP007412_kidney | 0 .00 RPM | 76 .60 RPM |
SRP007412_liver | 0 .03 RPM | 35 .83 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_3278 |
Gorilla gorilla | retro_ggor_48 |