RetrogeneDB ID: | retro_pabe_403 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:79713460..79713899(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GM2A | ||
Ensembl ID: | ENSPPYG00000015962 | ||
Aliases: | None | ||
Description: | GM2 ganglioside activator [Source:HGNC Symbol;Acc:4367] |
Percent Identity: | 63.27 % |
Parental protein coverage: | 75.26 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MQSVMQAPLLIALGLL---LAAPAQAHLKKLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMG |
.QS.M.AP.LI.LGLL...LAAPA..HL...SSF.WDN.D.GKD..VI.SL.LE.DP..VPGNV..S... | |
Retrocopy | VQSLMEAPFLIVLGLLLAGLAAPAHVHLNQISSFPWDNWDKGKDSVVIKSLSLEADPNVVPGNVIISAED |
Parental | S-TSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEQFCDVLDMLIPTGEPCPEPLRTYGLPCHCP |
..TSVPL.SPLK..L..EKEV.G.W.KI.C...IGSC..E.FCDVLD..I..GE.CPEPL..YGL.CHCP | |
Retrocopy | K>TSVPLKSPLKLELTVEKEVSGFWVKISCMEQIGSCAYEDFCDVLDTFIHPGELCPEPLHIYGLLCHCP |
Parental | FKEGTYS |
FK.GTYS | |
Retrocopy | FKVGTYS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .16 RPM |
SRP007412_cerebellum | 0 .00 RPM | 36 .12 RPM |
SRP007412_heart | 0 .00 RPM | 12 .94 RPM |
SRP007412_kidney | 0 .00 RPM | 34 .70 RPM |
SRP007412_liver | 0 .00 RPM | 20 .53 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_221 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000020587 | 1 retrocopy | |
Homo sapiens | ENSG00000196743 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015302 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000010421 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000000690 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003215 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022869 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010966 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015837 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000006171 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015962 | 1 retrocopy |
retro_pabe_403 ,
|
Pan troglodytes | ENSPTRG00000017431 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000028500 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000503 | 1 retrocopy |