RetrogeneDB ID: | retro_pabe_845 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 12:52906772..52907167(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VTI1B | ||
Ensembl ID: | ENSPPYG00000005927 | ||
Aliases: | None | ||
Description: | vesicle transport through interaction with t-SNAREs 1B [Source:HGNC Symbol;Acc:17793] |
Percent Identity: | 73.33 % |
Parental protein coverage: | 57.33 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EIFRGLHED-LQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNY |
E.F..LHE..LQGV...LLG.AGT.E..KLIRDFDEKQQEAN..LA.MEEEL.YAPLSF.NPMMSKLR.Y | |
Retrocopy | EHFEQLHEMCLQGVH*WLLGMAGTQE--KLIRDFDEKQQEANKMLAQMEEELHYAPLSFHNPMMSKLRDY |
Parental | RKDLAKLHREVRSTPL-TATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIER |
.KDLA.LH.E.RSTPL..A.P..RGDMKYG.YAVENEH.NRLQSQRAMLLQGT..L.RATQ.... | |
Retrocopy | QKDLAQLHLEARSTPL<AAMPRDRGDMKYGTYAVENEHVNRLQSQRAMLLQGTKILGRATQETDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 80 .61 RPM |
SRP007412_cerebellum | 0 .00 RPM | 47 .42 RPM |
SRP007412_heart | 0 .00 RPM | 29 .11 RPM |
SRP007412_kidney | 0 .00 RPM | 83 .36 RPM |
SRP007412_liver | 0 .00 RPM | 40 .30 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015263 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003643 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015939 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000006101 | 1 retrocopy | |
Felis catus | ENSFCAG00000014090 | 1 retrocopy | |
Homo sapiens | ENSG00000100568 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005620 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000004910 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000010843 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011184 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015866 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007130 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000780 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000005927 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000006468 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000011671 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000003049 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007688 | 2 retrocopies |