RetrogeneDB ID: | retro_ptro_751 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:36138877..36139272(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VTI1B | ||
Ensembl ID: | ENSPTRG00000006468 | ||
Aliases: | None | ||
Description: | Pan troglodytes vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), mRNA. [Source:RefSeq mRNA;Acc:NM_001252011] |
Percent Identity: | 71.85 % |
Parental protein coverage: | 57.33 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EIFRGLHED-LQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNY |
E.F..LHE..LQGV...LLG.AGT.E..KLIRDFDEKQQEAN..L..MEEEL.YAP.SF.NPMMSKL..Y | |
Retrocopy | EHFEQLHEMCLQGVH*WLLGMAGTQE--KLIRDFDEKQQEANKMLTQMEEELHYAPVSFHNPMMSKLQDY |
Parental | RKDLAKLHREVRSTPL-TATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIER |
.KDLA..H.E.RST.L..A.PG.RGDMKYG.YAVENEHMNRLQSQRAMLLQGT.SL.RATQ.... | |
Retrocopy | QKDLAQFHLEARSTAL<AAMPGDRGDMKYGTYAVENEHMNRLQSQRAMLLQGTKSLGRATQETDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .83 RPM |
SRP007412_cerebellum | 0 .00 RPM | 31 .04 RPM |
SRP007412_heart | 0 .00 RPM | 26 .17 RPM |
SRP007412_kidney | 0 .00 RPM | 44 .82 RPM |
SRP007412_liver | 0 .00 RPM | 34 .96 RPM |
SRP007412_testis | 0 .00 RPM | 89 .37 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1002 |
Gorilla gorilla | retro_ggor_797 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015263 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003643 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015939 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000006101 | 1 retrocopy | |
Felis catus | ENSFCAG00000014090 | 1 retrocopy | |
Homo sapiens | ENSG00000100568 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005620 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000004910 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000010843 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011184 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015866 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007130 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000780 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000005927 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000006468 | 3 retrocopies |
retro_ptro_1808, retro_ptro_2037, retro_ptro_751 ,
|
Pteropus vampyrus | ENSPVAG00000011671 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000003049 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007688 | 2 retrocopies |