RetrogeneDB ID: | retro_pabe_883 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 12:116560828..116561227(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | OSTF1 | ||
Ensembl ID: | ENSPPYG00000019300 | ||
Aliases: | None | ||
Description: | osteoclast-stimulating factor 1 [Source:RefSeq peptide;Acc:NP_001127367] |
Percent Identity: | 84.33 % |
Parental protein coverage: | 71.28 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG |
.SIDN.LHE.AKRGNLSWL.ECLDNRVGVNGLDKAGSTAL..ACHG...DIVEMLFTQP.I.L.QQNKL. | |
Retrocopy | QSIDNLLHEVAKRGNLSWLQECLDNRVGVNGLDKAGSTALD*ACHGDLRDIVEMLFTQPSI*LKQQNKLE |
Parental | DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNA |
DTALHAAAWK.YADIVQLLLAKGARTD.RN.EKKLA..MATNA..ASLLKKKQ.TDAVRTLSNA | |
Retrocopy | DTALHAAAWKSYADIVQLLLAKGARTD*RNNEKKLALGMATNAH-ASLLKKKQETDAVRTLSNA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .84 RPM |
SRP007412_cerebellum | 0 .00 RPM | 13 .13 RPM |
SRP007412_heart | 0 .00 RPM | 8 .73 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .27 RPM |
SRP007412_liver | 0 .00 RPM | 24 .85 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1058 |
Pan troglodytes | retro_ptro_720 |
Gorilla gorilla | retro_ggor_836 |
Macaca mulatta | retro_mmul_836 |
Callithrix jacchus | retro_cjac_3249 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000012808 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000007226 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000002933 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000008320 | 2 retrocopies | |
Felis catus | ENSFCAG00000022374 | 1 retrocopy | |
Homo sapiens | ENSG00000134996 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011920 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010401 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001854 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000002603 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019300 | 1 retrocopy |
retro_pabe_883 ,
|
Pan troglodytes | ENSPTRG00000021031 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012156 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000005273 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003081 | 1 retrocopy |