RetrogeneDB ID: | retro_pabe_908 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 12:19075909..19076239(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDFIP1 | ||
Ensembl ID: | ENSPPYG00000015896 | ||
Aliases: | None | ||
Description: | Nedd4 family interacting protein 1 [Source:HGNC Symbol;Acc:17592] |
Percent Identity: | 66.37 % |
Parental protein coverage: | 50.23 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAY-FDYKDESGFPKPPSYNVAT |
LAL.A..AVE..C.S.YQ.L..EEE..EPE.A.G..PPPY...SAES..Y.FDY.DES.FPKPP.YNV.. | |
Retrocopy | LALVAPVAVELVCSSKYQHL*DEEEPEEPEKASGEVPPPYGVNSAESMVY<FDYTDESNFPKPPFYNVVA |
Parental | -TLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIG |
.TLP.Y....R.KAEA...LVPGRDEDFVG.DDFDDADQLRIG | |
Retrocopy | >TLPIYNKVMRIKAEA-LSLVPGRDEDFVGQDDFDDADQLRIG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 236 .87 RPM |
SRP007412_cerebellum | 0 .00 RPM | 179 .60 RPM |
SRP007412_heart | 0 .00 RPM | 40 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 94 .07 RPM |
SRP007412_liver | 0 .00 RPM | 66 .34 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1091 |
Pan troglodytes | retro_ptro_743 |
Gorilla gorilla | retro_ggor_859 |
Macaca mulatta | retro_mmul_846 |
Callithrix jacchus | retro_cjac_3175 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047747 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018271 | 1 retrocopy | |
Equus caballus | ENSECAG00000021907 | 1 retrocopy | |
Homo sapiens | ENSG00000131507 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004879 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016787 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015896 | 1 retrocopy |
retro_pabe_908 ,
|
Pan troglodytes | ENSPTRG00000017358 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000002466 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000025295 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000005153 | 1 retrocopy |