RetrogeneDB ID: | retro_pcap_287 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | scaffold_273154:307..502(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPCAG00000000300 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.73 % |
| Parental protein coverage: | 50.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QEADNEVDEEEEEGG-EEEEEEE-EGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD |
| .....E.D.E....G..EEEEEE...DGEEEDG...E..E.ATGK..A.DDEDDD.D.KKQ...E.D | |
| Retrocopy | RKGEQEADNETD*EG>DEEEEEE<KRDGEEEDGHHEETTETATGKWVAGDDEDDDADSKKQMANEAD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006234 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000300 | 1 retrocopy |
retro_pcap_287 ,
|
| Tursiops truncatus | ENSTTRG00000009156 | 2 retrocopies |