RetrogeneDB ID: | retro_ptro_1079 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 15:86382483..86382865(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | IFT20 | ||
Ensembl ID: | ENSPTRG00000008911 | ||
Aliases: | None | ||
Description: | intraflagellar transport 20 homolog (Chlamydomonas) [Source:HGNC Symbol;Acc:30989] |
Percent Identity: | 61.54 % |
Parental protein coverage: | 96.97 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | KDILGEAGLHFDELNK-LRVLDPEVTQQTIELKEECKDFVDKIGQFQK-IVGGLIELVDQLAKEAENEKM |
.D.LGEAGL.FDEL.K...V.DPEVT.QT...KE.C.DFVDKI..FQK.IVGGLIE.VDQLAK.AENEK. | |
Retrocopy | QDSLGEAGLCFDELSK<AWVRDPEVT*QTRDPKEDCMDFVDKISPFQK<IVGGLIEPVDQLAKAAENEKR |
Parental | KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIF |
K..GA.NLL...AK.RE.QQQQL.A..AE.KM.L.R...EYEA..KV.A..........F | |
Retrocopy | KVVGAWNLLQFMAKHRETQQQQLLAQTAEEKMWLKRWWIEYEASWKVDAQKETHLLASLF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .05 RPM |
SRP007412_cerebellum | 0 .00 RPM | 11 .76 RPM |
SRP007412_heart | 0 .00 RPM | 3 .09 RPM |
SRP007412_kidney | 0 .00 RPM | 14 .64 RPM |
SRP007412_liver | 0 .00 RPM | 11 .92 RPM |
SRP007412_testis | 0 .11 RPM | 63 .44 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1217 |
Pongo abelii | retro_pabe_1322 |
Macaca mulatta | retro_mmul_2234 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005111 | 2 retrocopies | |
Bos taurus | ENSBTAG00000008110 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000003153 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000018843 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000008709 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000019233 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000014353 | 1 retrocopy | |
Mus musculus | ENSMUSG00000001105 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000007773 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003333 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000005826 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000008911 | 1 retrocopy |
retro_ptro_1079 ,
|
Sus scrofa | ENSSSCG00000023719 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000007554 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005557 | 2 retrocopies |