RetrogeneDB ID: | retro_ptro_1594 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2A:43357389..43357613(-) | ||
Located in intron of: | ENSPTRG00000011867 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYCBP | ||
Ensembl ID: | ENSPTRG00000000565 | ||
Aliases: | None | ||
Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
Percent Identity: | 60.53 % |
Parental protein coverage: | 72.82 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | HYKAADSKREQFRRYLEKSGVLDTLTKVLVALYE-EPEKPNSALDFLKHHLGAATPENPEIELLRLELAE |
HY........Q....LE....L...TKVLVAL...EPEKPN.A..FLKHHLG.A.PENPEIELL.LEL.E | |
Retrocopy | HYGPLEHC*LQDQAILEVLRALGC*TKVLVALEK<EPEKPNTA*VFLKHHLGVAIPENPEIELLPLELTE |
Parental | MKEKYE |
MK.KYE | |
Retrocopy | MKDKYE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 3 .81 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .31 RPM |
SRP007412_heart | 0 .00 RPM | 6 .70 RPM |
SRP007412_kidney | 0 .00 RPM | 22 .33 RPM |
SRP007412_liver | 0 .00 RPM | 7 .07 RPM |
SRP007412_testis | 0 .00 RPM | 29 .72 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1678 |