RetrogeneDB ID: | retro_ocun_907 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 17:21524588..21524831(+) | ||
| Located in intron of: | ENSOCUG00000007193 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYCBP | ||
| Ensembl ID: | ENSOCUG00000022203 | ||
| Aliases: | None | ||
| Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
| Percent Identity: | 81.48 % |
| Parental protein coverage: | 64.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKTKLAQ |
| VLDTLTKVL.AL..EPEKP.SALDFLKHHLGAATPEN.EIELLRL.LAE..EKYEA...EN.KLK.KLAQ | |
| Retrocopy | VLDTLTKVLAALHKEPEKPDSALDFLKHHLGAATPENAEIELLRLQLAEVEEKYEATKGEN*KLKIKLAQ |
| Parental | YEPPQEEKRAE |
| .EPPQEEK.AE | |
| Retrocopy | QEPPQEEKHAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 2 .26 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .22 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .31 RPM |