RetrogeneDB ID: | retro_cpor_1195 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_54:8810942..8811193(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYCBP | ||
| Ensembl ID: | ENSCPOG00000020447 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.47 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | ATVSGASYAVAPVTMAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA-A |
| ATVSG.SY...PVTMAH.KAA....EQF..Y.EKSGVLDT.TKVLVALYEEP..PNSALDF.KHHLGA.. | |
| Retrocopy | ATVSGTSYPTVPVTMAHCKAAELNIEQFWKYMEKSGVLDTFTKVLVALYEEP*EPNSALDF*KHHLGA<C |
| Parental | TPENPEIELLRLELA |
| TPENPEI.LL.LELA | |
| Retrocopy | TPENPEIKLLCLELA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .61 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .47 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .36 RPM |
| SRP040447_lung | 0 .03 RPM | 5 .27 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 2 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030622 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013136 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036558 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000020447 | 1 retrocopy |
retro_cpor_1195 ,
|
| Homo sapiens | ENSG00000214114 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005810 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000020514 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000315 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028647 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011814 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022203 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024435 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000001515 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000565 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017166 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003649 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000021547 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005690 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009583 | 1 retrocopy |