RetrogeneDB ID: | retro_ptro_1748 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2B:228007813..228008207(-) | ||
| Located in intron of: | ENSPTRG00000012976 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATG12 | ||
| Ensembl ID: | ENSPTRG00000017154 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes ATG12 autophagy related 12 homolog (ATG12), mRNA. [Source:RefSeq mRNA;Acc:NM_001251998] |
| Percent Identity: | 53.24 % |
| Parental protein coverage: | 71.66 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | LHALSRYFRSRVFPSKMAEEPQSVLQLPPSSAAGGEGLT-DVSPETTTPEPPSSAAVSPGTEEPAGDTKK |
| L..L...F.................QLPP..AAG..GLT..VSP.......P......PGT..PAG..KK | |
| Retrocopy | LPLLNNPFQNLTWDLTRWQKLKTMSQLPPLTAAGSKGLTLEVSPKQAL-QTPLIPR*FPGTQDPAGNIKK |
| Parental | KI-DILLKAVGDTPIMKTKKWAVERTRTIQGLIDFI-KKFLKLVASEQLFIYVNQ-SFAP-SPDQEVGT |
| ...DILLKAVG..PIMKTKK.AVE.TRTIQ.L.DFI.KKFLKL....QLFIYV.Q..FAP.S.DQE.GT | |
| Retrocopy | NL<DILLKAVGHVPIMKTKKQAVE*TRTIQRLLDFI>KKFLKL--APQLFIYVSQ<GFAP<SLDQEFGT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 10 .47 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .40 RPM |
| SRP007412_heart | 0 .03 RPM | 6 .73 RPM |
| SRP007412_kidney | 0 .03 RPM | 8 .39 RPM |
| SRP007412_liver | 0 .03 RPM | 11 .36 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .06 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1814 |
| Pongo abelii | retro_pabe_2158 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004464 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007187 | 2 retrocopies | |
| Equus caballus | ENSECAG00000012452 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018837 | 1 retrocopy | |
| Homo sapiens | ENSG00000145782 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016888 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015307 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002759 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015699 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000017154 | 2 retrocopies |
retro_ptro_1240, retro_ptro_1748 ,
|
| Rattus norvegicus | ENSRNOG00000000157 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011755 | 1 retrocopy |