RetrogeneDB ID: | retro_ptro_2156 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:64121613..64122040(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOH | ||
Ensembl ID: | ENSPTRG00000000753 | ||
Aliases: | LOC100613301, MAGOH, MAGOHB | ||
Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
Percent Identity: | 74.66 % |
Parental protein coverage: | 99.32 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | ESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITK |
ES.FYL.YYV.HK.KF.HEFLE.EF.PD.KLR.ANNSNYK..VMIRKEAY..K..MEELKRII..SEITK | |
Retrocopy | ESNFYLHYYVSHKDKFDHEFLEIEFQPDKKLRCANNSNYKDNVMIRKEAYIYKNMMEELKRIINGSEITK |
Parental | EDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQD-LKCLVFSLIGLH |
..DALWPPPD.....ELEIVIG.EH.SF.TSKIGSLIDV.QSKDPEGLR.FYYLV.D..K.LVF....LH | |
Retrocopy | *YDALWPPPD---QEELEIVIGHEHVSFITSKIGSLIDVKQSKDPEGLRIFYYLVHD>RKYLVFIVTELH |
Parental | FKIKPI |
FKIKPI | |
Retrocopy | FKIKPI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .11 RPM |
SRP007412_cerebellum | 0 .00 RPM | 11 .15 RPM |
SRP007412_heart | 0 .00 RPM | 13 .06 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .92 RPM |
SRP007412_liver | 0 .00 RPM | 23 .24 RPM |
SRP007412_testis | 0 .00 RPM | 23 .08 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3318 |
Gorilla gorilla | retro_ggor_1303 |
Pongo abelii | retro_pabe_2733 |
Callithrix jacchus | retro_cjac_1858 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
Homo sapiens | ENSG00000162385 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001335 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy |
retro_ptro_2156 ,
|
Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |