RetrogeneDB ID: | retro_ptro_932 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 14:68025522..68025819(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOHB | ||
Ensembl ID: | ENSPTRG00000004679 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88.89 % |
Parental protein coverage: | 66.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE |
M.MASDFYLRYYVGHKGKFGHEFLE.EF..DGKLRYANNSNYKNDVMIRKEAYVHKS.MEELKR.IDD.E | |
Retrocopy | MVMASDFYLRYYVGHKGKFGHEFLESEFQLDGKLRYANNSNYKNDVMIRKEAYVHKSLMEELKRLIDDNE |
Parental | ITKEDDALWPPPDRVGRQELEIVIGDEHI |
I.KEDD.LWPPPDR.G.QELEIVIGDEHI | |
Retrocopy | IIKEDDGLWPPPDRAGQQELEIVIGDEHI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .07 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .16 RPM |
SRP007412_heart | 0 .00 RPM | 3 .09 RPM |
SRP007412_kidney | 0 .03 RPM | 4 .29 RPM |
SRP007412_liver | 0 .00 RPM | 7 .01 RPM |
SRP007412_testis | 0 .00 RPM | 5 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1360 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
Homo sapiens | ENSG00000111196 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies |
retro_ptro_1179, retro_ptro_932 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies | |
Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies |