RetrogeneDB ID: | retro_ptro_2168 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:96476409..96476660(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX19 | ||
Ensembl ID: | ENSPTRG00000041621 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly homolog 19 (S. cerevisiae) [Source:HGNC Symbol;Acc:28074] |
Percent Identity: | 50.59 % |
Parental protein coverage: | 68.85 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFK-EKFMKCLHNNNFENALCRNESKEYLECRMERSRLG |
MSTA.N..TK.FQ..P.DKGSFPL......KS.K.EKFM.CLH.N.....L..N.SK.Y.ECRMER.... | |
Retrocopy | MSTAINLRTKIFQAWPLDKGSFPLKLFNKYKSLK<EKFMRCLHDNKCKHILQKNKSKAYSECRMERQQKV |
Parental | LLHSGRLHLPELLGN |
....G.L....L..N | |
Retrocopy | *KPRGTLGFGDLIEN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 135 .15 RPM |
SRP007412_cerebellum | 0 .00 RPM | 35 .81 RPM |
SRP007412_heart | 0 .00 RPM | 3 .67 RPM |
SRP007412_kidney | 0 .00 RPM | 8 .11 RPM |
SRP007412_liver | 0 .00 RPM | 22 .00 RPM |
SRP007412_testis | 0 .00 RPM | 2 .53 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3300 |
Gorilla gorilla | retro_ggor_1312 |
Macaca mulatta | retro_mmul_2067 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015253 | 1 retrocopy | |
Homo sapiens | ENSG00000240230 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000034907 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007202 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000041621 | 1 retrocopy |
retro_ptro_2168 ,
|
Pteropus vampyrus | ENSPVAG00000002192 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000011489 | 2 retrocopies |