RetrogeneDB ID: | retro_ttru_1270 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_109204:128164..128402(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX19 | ||
Ensembl ID: | ENSTTRG00000011489 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly homolog 19 (S. cerevisiae) [Source:HGNC Symbol;Acc:28074] |
Percent Identity: | 66.25 % |
Parental protein coverage: | 86.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | STAMNFGSKSFQ-PRP-PDKGSFPLDHFGECKSFKERFMKCLRDNNFENALCRNESKEYLECRMERQLMV |
S.AM.F.SK.FQ.P.P.PDKG...LDHFGECKSFKE.FMKCL..N.F.N.L.......YLECRMERQLM. | |
Retrocopy | SMAMIFRSKCFQ>PGPAPDKGGCLLDHFGECKSFKENFMKCLQGNSFDNTLQK*IKTMYLECRMERQLML |
Parental | PEPLEKLGFG |
..PLEKL.FG | |
Retrocopy | QKPLEKLEFG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015253 | 1 retrocopy | |
Homo sapiens | ENSG00000240230 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000034907 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007202 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000041621 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000002192 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000011489 | 2 retrocopies |
retro_ttru_1140, retro_ttru_1270 ,
|