RetrogeneDB ID: | retro_ptro_2190 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:133604189..133604412(+) | ||
Located in intron of: | ENSPTRG00000017228 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0E1 | ||
Ensembl ID: | ENSPTRG00000017538 | ||
Aliases: | ATP6V0E1, ATP6V0E | ||
Description: | None |
Percent Identity: | 72.5 % |
Parental protein coverage: | 97.53 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | YHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCY-LFWLIAILAQLNPLFGPQLKNE |
YHGLT....V.S.FWGFVGF.VP.F.PK.PN.GVIITM.VTCSV.C..LFWLIAILAQ.NPL..P.LK.E | |
Retrocopy | YHGLT----VTSMFWGFVGFFVP*FVPKRPNWGVIITMMVTCSV-CH>LFWLIAILAQCNPLYRP*LKDE |
Parental | TIWYLKYHWP |
T.WYLK.HWP | |
Retrocopy | TTWYLKHHWP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 18 .36 RPM |
SRP007412_cerebellum | 0 .14 RPM | 11 .40 RPM |
SRP007412_heart | 0 .00 RPM | 43 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 127 .49 RPM |
SRP007412_liver | 0 .03 RPM | 76 .93 RPM |
SRP007412_testis | 0 .00 RPM | 26 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3240 |
Gorilla gorilla | retro_ggor_2206 |
Pongo abelii | retro_pabe_2688 |
Callithrix jacchus | retro_cjac_1923 |