RetrogeneDB ID: | retro_pabe_2006 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2a:78379399..78379641(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSPPYG00000029669 | ||
| Aliases: | None | ||
| Description: | V-type proton ATPase subunit e 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5RAV0] |
| Percent Identity: | 76.83 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILA-QLNPLFGPQLK |
| M.Y.GLT.PLI.MSVFWGF..F..PWFIPKGPN.GVIIT.LVTCSVCC.LFWLIAILA.QLNPLF..QLK | |
| Retrocopy | MVYQGLTIPLIAMSVFWGFTDFFMPWFIPKGPN*GVIITILVTCSVCCCLFWLIAILA<QLNPLFRLQLK |
| Parental | NETIWYLKYHWP |
| .E..W.LK.HWP | |
| Retrocopy | HEIMWCLKCHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .83 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .69 RPM |
| SRP007412_heart | 0 .00 RPM | 44 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 180 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 115 .18 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2090 |
| Pan troglodytes | retro_ptro_1537 |
| Gorilla gorilla | retro_ggor_1632 |
| Macaca mulatta | retro_mmul_983 |
| Callithrix jacchus | retro_cjac_1296 |