RetrogeneDB ID: | retro_ptro_2579 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:143282667..143283090(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYL6B | ||
Ensembl ID: | ENSPTRG00000023043 | ||
Aliases: | None | ||
Description: | myosin, light chain 6B, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:29823] |
Percent Identity: | 67.59 % |
Parental protein coverage: | 68.27 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | VIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETF |
V..F..DQ..EFKE.F.LFD..GDGKILYSQCGDVMR.LG.NPT.AEV..VL..PKSDE......DF..F | |
Retrocopy | VCDFTEDQTTEFKEVF*LFD*TGDGKILYSQCGDVMRVLGENPTDAEVMQVLEIPKSDEMNVTVLDFGHF |
Parental | LPMLQAVAKNR-GQG-TYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVL-AGHEDSNG |
LPMLQAVAKNR.G.G..YEDY.EGL.VFDK.GNG..MG.E...VL.TLGEKM.EEEV.....AGH.DSNG | |
Retrocopy | LPMLQAVAKNR<GPG<AYEDYVEGLWVFDKKGNGTIMGTEI*QVLVTLGEKMIEEEVKMLV<AGHKDSNG |
Parental | CINYE |
CIN.E | |
Retrocopy | CINCE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 73 .86 RPM |
SRP007412_cerebellum | 0 .00 RPM | 48 .61 RPM |
SRP007412_heart | 0 .00 RPM | 13 .93 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .79 RPM |
SRP007412_liver | 0 .00 RPM | 4 .39 RPM |
SRP007412_testis | 0 .21 RPM | 34 .35 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000000110 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011620 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007592 | 1 retrocopy | |
Homo sapiens | ENSG00000196465 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003277 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000012658 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005214 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026948 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017368 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001521 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000005927 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005080 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies |
retro_ptro_1741, retro_ptro_2579 ,
|
Rattus norvegicus | ENSRNOG00000028837 | 2 retrocopies |