RetrogeneDB ID: | retro_ptro_1476 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 21:29851201..29851629(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYL6 | ||
Ensembl ID: | ENSPTRG00000005080 | ||
Aliases: | None | ||
Description: | myosin, light chain 6, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:7587] |
Percent Identity: | 75. % |
Parental protein coverage: | 94.7 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | TAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTV |
..EFK.AF.LFD.TGDGK.L..S.CGDVMRALGQNPTNA..L.VLGNPKSDEMNVKVLDFEHFLP.LQTV | |
Retrocopy | STEFKAAFRLFD*TGDGKVL<SSPCGDVMRALGQNPTNATALEVLGNPKSDEMNVKVLDFEHFLPLLQTV |
Parental | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRH |
A.N.DQGT.EDYVE.L.VFDKE.NGTVM..EI.HVLV.LGE.MTE...EMLVAGHEDS.GC...E..VR. | |
Retrocopy | AGNRDQGT*EDYVERLQVFDKEENGTVMSTEIQHVLVSLGEEMTERGGEMLVAGHEDSSGCTDSEVLVRR |
Parental | ILSG |
.L.G | |
Retrocopy | LLKG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 278 .04 RPM |
SRP007412_cerebellum | 0 .14 RPM | 194 .80 RPM |
SRP007412_heart | 0 .00 RPM | 205 .71 RPM |
SRP007412_kidney | 0 .03 RPM | 841 .02 RPM |
SRP007412_liver | 0 .00 RPM | 484 .63 RPM |
SRP007412_testis | 0 .00 RPM | 116 .76 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2533 |
Pongo abelii | retro_pabe_1864 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000092841 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005080 | 2 retrocopies |
retro_ptro_1196, retro_ptro_1476 ,
|
Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
Sus scrofa | ENSSSCG00000025467 | 1 retrocopy |