RetrogeneDB ID: | retro_ptro_274 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:14792867..14793146(-) | ||
Located in intron of: | ENSPTRG00000000186 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TBCA | ||
Ensembl ID: | ENSPTRG00000017013 | ||
Aliases: | None | ||
Description: | tubulin folding cofactor A [Source:HGNC Symbol;Acc:11579] |
Percent Identity: | 84.95 % |
Parental protein coverage: | 86.11 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENE |
V.R.VKEK..Y.KEAK.QEEKIEKMRAEDGENY.IKKQAEILQES.MMIPDCQRRLEAAYLDLQ..LE.E | |
Retrocopy | VCRSVKEKLTYGKEAK*QEEKIEKMRAEDGENYAIKKQAEILQESQMMIPDCQRRLEAAYLDLQQMLESE |
Parental | KDLEEAEEYKEARLVLDSVKLEA |
KDLE..EEYKEA.LVLDSVKLEA | |
Retrocopy | KDLEDTEEYKEAHLVLDSVKLEA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 8 .87 RPM |
SRP007412_cerebellum | 0 .14 RPM | 1 .22 RPM |
SRP007412_heart | 0 .00 RPM | 0 .41 RPM |
SRP007412_kidney | 0 .03 RPM | 1 .26 RPM |
SRP007412_liver | 0 .00 RPM | 1 .37 RPM |
SRP007412_testis | 0 .00 RPM | 0 .32 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_346 |
Callithrix jacchus | retro_cjac_2974 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000014223 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000019848 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000012187 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016572 | 1 retrocopy | |
Homo sapiens | ENSG00000171530 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000011853 | 1 retrocopy | |
Mus musculus | ENSMUSG00000042043 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000010198 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002460 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000015579 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000017013 | 2 retrocopies |
retro_ptro_2067, retro_ptro_274 ,
|
Rattus norvegicus | ENSRNOG00000048342 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009943 | 1 retrocopy |