RetrogeneDB ID: | retro_ptro_2949 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | AACZ03172105.1:5..353(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BLOC1S6 | ||
| Ensembl ID: | ENSPTRG00000007038 | ||
| Aliases: | None | ||
| Description: | biogenesis of lysosomal organelles complex-1, subunit 6, pallidin [Source:HGNC Symbol;Acc:8549] |
| Percent Identity: | 92.24 % |
| Parental protein coverage: | 67.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLH |
| LSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLH | |
| Retrocopy | LSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLH |
| Parental | EKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM |
| .........ALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM | |
| Retrocopy | XXXXXXXXXALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 2 .88 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 3 .55 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .26 RPM |
| SRP007412_kidney | 0 .03 RPM | 3 .16 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .54 RPM |
| SRP007412_testis | 0 .21 RPM | 4 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012059 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019785 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000007378 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013892 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012636 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005595 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017628 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017351 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013706 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007038 | 1 retrocopy |
retro_ptro_2949 ,
|