RetrogeneDB ID: | retro_ptro_524 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 10:119130484..119130715(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXN | ||
Ensembl ID: | ENSPTRG00000021245 | ||
Aliases: | None | ||
Description: | thioredoxin [Source:HGNC Symbol;Acc:12435] |
Percent Identity: | 83.12 % |
Parental protein coverage: | 73.33 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE |
MVKQIESK.AFQE.L.AAGDK.V.VDFSATW.GPCK.IK.FFHSLSEKYSN..F.EV.V.DCQDVASECE | |
Retrocopy | MVKQIESKVAFQEGLEAAGDKFVMVDFSATWYGPCKKIKLFFHSLSEKYSNMVFFEVHVADCQDVASECE |
Parental | VKCMPTF |
VKCMPTF | |
Retrocopy | VKCMPTF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 53 .78 RPM |
SRP007412_cerebellum | 0 .00 RPM | 42 .84 RPM |
SRP007412_heart | 0 .00 RPM | 33 .31 RPM |
SRP007412_kidney | 0 .00 RPM | 134 .84 RPM |
SRP007412_liver | 0 .03 RPM | 144 .91 RPM |
SRP007412_testis | 0 .74 RPM | 12 .12 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_736 |
Gorilla gorilla | retro_ggor_620 |