RetrogeneDB ID: | retro_ptro_877 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 13:89103978..89104411(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GRPEL2 | ||
Ensembl ID: | ENSPTRG00000017396 | ||
Aliases: | None | ||
Description: | GrpE protein homolog [Source:UniProtKB/TrEMBL;Acc:H2QRR7] |
Percent Identity: | 75.5 % |
Parental protein coverage: | 66.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MAVRSLWAGRLRVHRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLE |
.AV..LW........LLA.SA.WE.KGW.L.FSTA.QRT.GEDC.SEDPPDELG..LAE.ALRVKAVKLE | |
Retrocopy | LAVQLLW----QMQPLLASSAEWEGKGWLLLFSTAMQRTTGEDCSSEDPPDELGCSLAEWALRVKAVKLE |
Parental | KEVQDLTVRYQRAIADCENIRRRT-QRCVEDAKIFGIQSFCKDLVEVA-DILEKTTECISEESEPEDQKL |
KEVQDLT.RYQRA.ADCENIRR.T.QRCVE..KIF.IQSFCK.LVEV...ILEKTTECISEES.P.DQKL | |
Retrocopy | KEVQDLTMRYQRAVADCENIRRGT<QRCVENSKIFRIQSFCKILVEVS<HILEKTTECISEESDPVDQKL |
Parental | TLEKVFRGLLL |
TLEKVF.GL.L | |
Retrocopy | TLEKVFQGLSL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 11 .46 RPM |
SRP007412_cerebellum | 0 .00 RPM | 17 .28 RPM |
SRP007412_heart | 0 .00 RPM | 9 .56 RPM |
SRP007412_kidney | 0 .03 RPM | 10 .93 RPM |
SRP007412_liver | 0 .00 RPM | 4 .62 RPM |
SRP007412_testis | 0 .00 RPM | 13 .81 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1284 |
Pongo abelii | retro_pabe_1063 |
Macaca mulatta | retro_mmul_1317 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004070 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011142 | 1 retrocopy | |
Felis catus | ENSFCAG00000003624 | 1 retrocopy | |
Homo sapiens | ENSG00000164284 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005410 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021662 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010160 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016138 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000014326 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015933 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000015894 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000017396 | 2 retrocopies |
retro_ptro_3226, retro_ptro_877 ,
|
Sorex araneus | ENSSARG00000005467 | 2 retrocopies |