RetrogeneDB ID: | retro_ptro_989 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 14:91138127..91138575(-) | ||
Located in intron of: | ENSPTRG00000006640 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLR3G | ||
Ensembl ID: | ENSPTRG00000017068 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 80. % |
Parental protein coverage: | 66.37 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR |
MAGNKG.G.AAYTFNIEAVGFSKG.KLPDVVLKPPPLFPDTDYKPVPLKTGEGE.YMLALKQELRETMKR | |
Retrocopy | MAGNKG*GCAAYTFNIEAVGFSKGKKLPDVVLKPPPLFPDTDYKPVPLKTGEGE*YMLALKQELRETMKR |
Parental | MPYF-IETP-EERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTSLTNT |
MPYF....P.EERQDI.RYSKRY.KVYKEEWIPDWRRLPREMMP...............D.GKGTSLTNT | |
Retrocopy | MPYF>LKHPHEERQDIKRYSKRYVKVYKEEWIPDWRRLPREMMPXXXXXXXXXXXXXXXDTGKGTSLTNT |
Parental | EDVLKKMEEL |
.DV.KK.EEL | |
Retrocopy | ADVFKKIEEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .40 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .38 RPM |
SRP007412_heart | 0 .00 RPM | 1 .40 RPM |
SRP007412_kidney | 0 .00 RPM | 2 .30 RPM |
SRP007412_liver | 0 .00 RPM | 2 .98 RPM |
SRP007412_testis | 0 .00 RPM | 6 .64 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1454 |
Gorilla gorilla | retro_ggor_1119 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006306 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010747 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008379 | 1 retrocopy | |
Homo sapiens | ENSG00000113356 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000000266 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014954 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000018972 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013749 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000005560 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015624 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000017068 | 2 retrocopies |
retro_ptro_1266, retro_ptro_989 ,
|
Rattus norvegicus | ENSRNOG00000016260 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000008664 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002278 | 2 retrocopies |