RetrogeneDB ID: | retro_rnor_1721 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 20:16309172..16309412(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Erh | ||
Ensembl ID: | ENSRNOG00000004883 | ||
Aliases: | None | ||
Description: | enhancer of rudimentary homolog [Source:RefSeq peptide;Acc:NP_001102912] |
Percent Identity: | 70.73 % |
Parental protein coverage: | 67.21 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | RPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPY |
RPE.RTYAD.ESVN..MEGVC...E..LKRMNPNSPSI.Y....LF.FIDD.ADLSCLVY.ADTQT.QPY | |
Retrocopy | RPESRTYAD*ESVNVGMEGVCRCMENNLKRMNPNSPSIPYEF--LFEFIDDRADLSCLVY*ADTQTCQPY |
Parental | NKDWIKEKIYVL |
N..W.KE...VL | |
Retrocopy | NRGWVKENYEVL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .39 RPM |
SRP017611_kidney | 0 .00 RPM | 23 .17 RPM |
SRP017611_liver | 0 .00 RPM | 10 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014529 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000006912 | 3 retrocopies | |
Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014602 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021571 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000029388 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000004883 | 3 retrocopies |
retro_rnor_1721 , retro_rnor_2670, retro_rnor_308,
|