RetrogeneDB ID: | retro_rnor_2515 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 7:27096546..27096885(-) | ||
| Located in intron of: | ENSRNOG00000009088 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Nsmce4a | ||
| Ensembl ID: | ENSRNOG00000020452 | ||
| Aliases: | Nsmce4a, RGD1309025 | ||
| Description: | non-structural maintenance of chromosomes element 4 homolog A [Source:RefSeq peptide;Acc:NP_001099771] |
| Percent Identity: | 63.72 % |
| Parental protein coverage: | 52.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MDPACLEAEYDQGLCRQIRHQYRALINSVQQNREDILN-AGDKLTEVLEEANTLFNEVSRAREAVLDAQF |
| M.P..LE...D...CR.IR.QYR.LI..VQQNREDI.N.A.D.LTE.LEEAN.LF..VSR.REA.LDAQF | |
| Retrocopy | MHPDLLELAVDREKCRSIRRQYRQLIYTVQQNREDIVNTASDSLTEALEEANVLFDGVSRTREAALDAQF |
| Parental | LVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAE |
| LVLASDLGKEKAKQL.SD.S.F......E.LL...G.N..E.E | |
| Retrocopy | LVLASDLGKEKAKQLNSDMSFFNHVAFCELLLVFVGLNWMEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .07 RPM | 9 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .17 RPM |
| SRP017611_liver | 0 .20 RPM | 5 .51 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010897 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000019166 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012419 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003695 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003880 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016651 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014906 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003647 | 1 retrocopy | |
| Homo sapiens | ENSG00000107672 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004214 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012044 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002960 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016919 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010026 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000002712 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017186 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020452 | 1 retrocopy |
retro_rnor_2515 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000011112 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000006534 | 1 retrocopy |