RetrogeneDB ID: | retro_sara_97 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | GeneScaffold_2823:154045..154414(+) | ||
| Located in intron of: | ENSSARG00000010673 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB2B | ||
| Ensembl ID: | ENSSARG00000004969 | ||
| Aliases: | None | ||
| Description: | RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:20246] |
| Percent Identity: | 59.69 % |
| Parental protein coverage: | 58.8 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | RSYYRGAAGALLVYDIT-RRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKKEEGEAFAREH |
| .S...GAAG.LLVY......ETF..L.S.LE...QHSSSNMVIM.I.NK.DLE...DVKK..GE.F..EH | |
| Retrocopy | KSVIWGAAGVLLVYNVK<EHETFS-LLS*LENLWQHSSSNMVIMVIRNKCDLETCKDVKK--GEVFVQEH |
| Parental | -GLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVSNEANGIKIGPQQSISTPVGP |
| .GL.......K...NVEEAFINTAKE.Y.KI.QGL.DVSNEANG.KI..QQ..S..V.P | |
| Retrocopy | >GLYSLKSQLKQL-NVEEAFINTAKETYWKIHQGLLDVSNEANGFKIDSQQCHSISVEP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000044207 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000005641 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000710 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000026575 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010489 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001902 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000004969 | 1 retrocopy |
retro_sara_97 ,
|
| Sorex araneus | ENSSARG00000013511 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001886 | 1 retrocopy |