RetrogeneDB ID: | retro_sscr_845 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:87997495..87997705(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSSSCG00000009146 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 59.83 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTK |
| VQ.LTY..R.SY...SNK.R.S.TPGNRIVYL.T.KVGKA.KS....CPG.L.GVR.VR.KVL..LSK.K | |
| Retrocopy | VQHLTYYQRFSYSSTSNKARPS*TPGNRIVYLSTEKVGKALKSTYSRCPGQLKGVRVVRGKVLRSLSKQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 100 .88 RPM |
| SRP014902_testis | 0 .00 RPM | 599 .73 RPM |
| SRP018288_heart | 0 .00 RPM | 233 .25 RPM |
| SRP018288_kidney | 0 .00 RPM | 294 .53 RPM |
| SRP018288_liver | 0 .00 RPM | 280 .48 RPM |
| SRP018288_lung | 0 .00 RPM | 321 .06 RPM |
| SRP018856_adipose | 0 .00 RPM | 673 .61 RPM |
| SRP035408_brain | 0 .00 RPM | 263 .77 RPM |
| SRP035408_liver | 0 .00 RPM | 204 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Bos taurus | retro_btau_1303 |