RetrogeneDB ID: | retro_tsyr_10 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_553315:449..683(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSTSYG00000002086 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTSYG00000010251 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 93.51 % |
Parental protein coverage: | 85.56 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GLVCAGLADMARPAEKLSTAQSAVLMATGLIWSRYSLVIIPKNWNLFAVNFFVGTARSSHLFRIWRYNQE |
GLVCAGLADMARPAEKLSTAQSAVLMATG.IWSRYSLVI.PKNWNLFAVNFFVGTA..S.LFRIWRYNQE | |
Retrocopy | GLVCAGLADMARPAEKLSTAQSAVLMATGFIWSRYSLVIVPKNWNLFAVNFFVGTAGASQLFRIWRYNQE |
Parental | LKAKANK |
LKAKANK | |
Retrocopy | LKAKANK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006273 | 2 retrocopies | |
Bos taurus | ENSBTAG00000020968 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000015358 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007752 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000016985 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000003860 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000011180 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011691 | 5 retrocopies | |
Myotis lucifugus | ENSMLUG00000011873 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010387 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026568 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000003130 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000006304 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014189 | 9 retrocopies | |
Tarsius syrichta | ENSTSYG00000010251 | 3 retrocopies |
retro_tsyr_10 , retro_tsyr_141, retro_tsyr_1810,
|
Tursiops truncatus | ENSTTRG00000008566 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000010556 | 1 retrocopy |