RetrogeneDB ID: | retro_ttru_503 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_2508:24580..24768(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTTRG00000002964 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.76 % |
| Parental protein coverage: | 54.17 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYK-GSCFHRIIPGFMCQGG |
| MVNP.VFF.I....EPLG..SF.LFADKVPKTAEN.RALSTGEK.FGY..GS.FHR.I.GFMCQGG | |
| Retrocopy | MVNPSVFFHIV--SEPLGCISFRLFADKVPKTAENLRALSTGEKRFGYE<GSSFHRSIQGFMCQGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000011597 | 12 retrocopies | |
| Monodelphis domestica | ENSMODG00000016089 | 9 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002964 | 16 retrocopies | |
| Tursiops truncatus | ENSTTRG00000014385 | 1 retrocopy |