RetrogeneDB ID: | retro_acar_106 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
Coordinates: | 3:72919890..72920118(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBFD1 | ||
Ensembl ID: | ENSACAG00000029331 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 93.42 % |
Parental protein coverage: | 56.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWV |
.SGMYNKSGGKV.LTFK.EQDQLWIGTKERTEKLPMGS.KNVVSEPIEGHEDYHMMAF.LGPTEASYYWV | |
Retrocopy | ISGMYNKSGGKVQLTFKFEQDQLWIGTKERTEKLPMGSVKNVVSEPIEGHEDYHMMAFHLGPTEASYYWV |
Parental | YWVPTQ |
YWVPTQ | |
Retrocopy | YWVPTQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP009831_adrenal | 0 .00 RPM | 7 .48 RPM |
SRP009831_brain | 0 .00 RPM | 5 .68 RPM |
SRP009831_dewlap | 0 .00 RPM | 66 .44 RPM |
SRP009831_embryo | 0 .00 RPM | 7 .68 RPM |
SRP009831_heart | 0 .00 RPM | 14 .27 RPM |
SRP009831_liver | 0 .00 RPM | 8 .47 RPM |
SRP009831_lung | 0 .00 RPM | 14 .51 RPM |
SRP009831_ovary | 0 .00 RPM | 79 .11 RPM |
SRP009831_skeletal_muscle | 0 .00 RPM | 32 .96 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000029331 | 2 retrocopies |
retro_acar_106 , retro_acar_204,
|
Canis familiaris | ENSCAFG00000017670 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020614 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006872 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000006727 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008444 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007191 | 1 retrocopy |