RetrogeneDB ID: | retro_amel_591 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
Coordinates: | GL192515.1:211070..211294(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PET100 | ||
Ensembl ID: | ENSAMEG00000008524 | ||
Aliases: | None | ||
Description: | PET100 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:40038] |
Percent Identity: | 63.16 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MGVKLEVFRMTLYLTFPVAMFWIANQAEWFEDYVIQRKRELWPPEKEDQ-ELEEFKERIRKQR-EEKLLR |
MGVKLEVF.MT.YLTF.VAMFWIANQA..FED............EK....ELEEFK.RI...R.EEKLL. | |
Retrocopy | MGVKLEVFQMTCYLTFSVAMFWIANQAR*FEDCHTAQEGAMGT*EKDQHGELEEFKDRI*SNR<EEKLLC |
Parental | AAQQSS |
.AQQSS | |
Retrocopy | TAQQSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies |
retro_amel_591 , retro_amel_878,
|
Equus caballus | ENSECAG00000008451 | 1 retrocopy | |
Felis catus | ENSFCAG00000023931 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |