RetrogeneDB ID: | retro_fcat_1266 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C2:49172693..49172914(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PET100 | ||
Ensembl ID: | ENSFCAG00000023931 | ||
Aliases: | None | ||
Description: | PET100 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:40038] |
Percent Identity: | 58.67 % |
Parental protein coverage: | 98.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MGVKLEVFRMTLY-LTFPVAMFWIANQAEWFEDYVIQRKRELWPPEKRRELEE--FKERIRKQREEKLLR |
MGVK.E...MTLY.L.FPVAMF.IA.QA.WFEDYVIQ.K.EL..P.K.....E..FK.RI.KQ.EEK... | |
Retrocopy | MGVKVEMLQMTLY<LRFPVAMF*IASQAGWFEDYVIQHKMELRLPMKEDQHRELGFKDRIWKQQEEKVCT |
Parental | AARQS |
....S | |
Retrocopy | VQKSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 8 .03 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .80 RPM |
SRP017611_liver | 0 .00 RPM | 3 .54 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies | |
Equus caballus | ENSECAG00000008451 | 1 retrocopy | |
Felis catus | ENSFCAG00000023931 | 2 retrocopies |
retro_fcat_1266 , retro_fcat_1752,
|
Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |