RetrogeneDB ID: | retro_fcat_1266 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:49172693..49172914(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PET100 | ||
| Ensembl ID: | ENSFCAG00000023931 | ||
| Aliases: | None | ||
| Description: | PET100 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:40038] |
| Percent Identity: | 58.67 % |
| Parental protein coverage: | 98.63 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MGVKLEVFRMTLY-LTFPVAMFWIANQAEWFEDYVIQRKRELWPPEKRRELEE--FKERIRKQREEKLLR |
| MGVK.E...MTLY.L.FPVAMF.IA.QA.WFEDYVIQ.K.EL..P.K.....E..FK.RI.KQ.EEK... | |
| Retrocopy | MGVKVEMLQMTLY<LRFPVAMF*IASQAGWFEDYVIQHKMELRLPMKEDQHRELGFKDRIWKQQEEKVCT |
| Parental | AARQS |
| ....S | |
| Retrocopy | VQKSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 8 .03 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .80 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies | |
| Equus caballus | ENSECAG00000008451 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023931 | 2 retrocopies |
retro_fcat_1266 , retro_fcat_1752,
|
| Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |