RetrogeneDB ID: | retro_amel_945 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
Coordinates: | GL192764.1:736937..737170(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP12 | ||
Ensembl ID: | ENSAMEG00000014554 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524] |
Percent Identity: | 63.29 % |
Parental protein coverage: | 55.71 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EISFKLGEEFEETTPGGHKTKSVITFDKDSLIQVQDWDGKENTIRRKLVDGKLVVESAMNNVICTRTYKR |
EI.FKL.EEFEET...G..T.S..T.D.D.LI.VQ.W.GK...IRRKLVDGK..VES.MNNV.CT.TY.R | |
Retrocopy | EIFFKLREEFEETVQAGQNTRSTVTLDNDPLI*VQAWAGKATPIRRKLVDGKMGVESTMNNVTCTSTYER |
Parental | V-QTNSNSN |
V...NS.SN | |
Retrocopy | V<IKNSSSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy |
retro_amel_945 ,
|
Ailuropoda melanoleuca | ENSAMEG00000014619 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
Homo sapiens | ENSG00000197416 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |