RetrogeneDB ID: | retro_lcha_45 | ||
Retrocopy location | Organism: | Coelacanth (Latimeria chalumnae) | |
| Coordinates: | JH126873.1:45236..45449(+) | ||
| Located in intron of: | ENSLACG00000000113 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSLACG00000008511 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.45 % |
| Parental protein coverage: | 52.99 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | TVKTTSVTFKLG-EEFDETTADDRKTKTVFNLENGKLIQVQKW-DGKETIIGRELKDGKMITVCTMGDVV |
| TVKTTS..FKLG.EEFDETT.DDRK.KT...LE.GKLIQVQKW.DGKET.I.RELKDGKMIT.CT.GD.V | |
| Retrocopy | TVKTTSLKFKLG<EEFDETTPDDRKMKTIIKLEDGKLIQVQKW>DGKETTIARELKDGKMITTCTLGDIV |
| Parental | CTR |
| CTR | |
| Retrocopy | CTR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| DRP000627_gill | 0 .00 RPM | 0 .12 RPM |
| DRP000627_kidney | 0 .00 RPM | 0 .04 RPM |
| DRP000627_pectoral_fin | 0 .00 RPM | 0 .06 RPM |
| DRP000627_pelvic_fin | 0 .00 RPM | 0 .11 RPM |
| DRP000627_pharynx | 0 .00 RPM | 0 .06 RPM |
| DRP000627_tail_muscle | 0 .00 RPM | 0 .02 RPM |