RetrogeneDB ID: | retro_btau_1004 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 23:16937590..16937972(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RWDD1 | ||
| Ensembl ID: | ENSBTAG00000009689 | ||
| Aliases: | None | ||
| Description: | RWD domain-containing protein 1 [Source:RefSeq peptide;Acc:NP_001029898] |
| Percent Identity: | 63.85 % |
| Parental protein coverage: | 52.67 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | DQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKK-KRMKEEEQAGKNKLSGR |
| ..IK.........K.....EAEKQLF.GTP.TI.NFL..KAKFD.ELLE....K.MK..EQAGK.KLSG. | |
| Retrocopy | NKIK*NGRSNRNLKTRRRAEAEKQLFYGTPITIQNFLS*KAKFDTELLEMFL<K*MKVKEQAGKSKLSGK |
| Parental | QLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDDDDPDYNPADR-ESDLTD |
| QLFETDHN.DT..IQFLEDAG..VEVDESL.Q...DL..ED..DDPDYNPAD..ESDLT. | |
| Retrocopy | QLFETDHNPDTANIQFLEDAGYSVEVDESLVQKLNDLDPEDKEDDPDYNPADQ<ESDLTN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 39 .00 RPM |
| ERP005899_muscle | 0 .00 RPM | 34 .31 RPM |
| SRP017611_brain | 0 .00 RPM | 17 .95 RPM |
| SRP017611_kidney | 0 .00 RPM | 34 .97 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .22 RPM |
| SRP030211_testis | 0 .00 RPM | 125 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005692 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000009689 | 1 retrocopy |
retro_btau_1004 ,
|
| Callithrix jacchus | ENSCJAG00000004474 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006587 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000019085 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000008170 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017837 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013592 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005016 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020231 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000022124 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002543 | 2 retrocopies |