RetrogeneDB ID: | retro_btau_1441 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 5:96152813..96153121(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMCO1 | ||
Ensembl ID: | ENSBTAG00000010009 | ||
Aliases: | None | ||
Description: | Transmembrane and coiled-coil domain-containing protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q3T0N3] |
Percent Identity: | 66.98 % |
Parental protein coverage: | 54.79 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | MVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKL-PFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMS |
M..MKS.FAIG.CFTA..G.F.SIFDGR.V....P.T.LS.I.GL....LL..DT.DCS.IFL.ILCTMS | |
Retrocopy | MA*MKSLFAIGVCFTAQVGIFKSIFDGRMVTWV>PPTLLSFI*GLPQGSLLEADTIDCSTIFLCILCTMS |
Parental | -IRQNIQKI-LGLAPSRAATKQAGGFLGPPPPSGKF |
.I.QNIQKI.L.LA.S.AATK..GGFLGP.PPSGKF | |
Retrocopy | <IGQNIQKI<LSLALSQAATKHTGGFLGPLPPSGKF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 53 .21 RPM |
ERP005899_muscle | 0 .00 RPM | 49 .73 RPM |
SRP017611_brain | 0 .00 RPM | 46 .73 RPM |
SRP017611_kidney | 0 .00 RPM | 36 .57 RPM |
SRP017611_liver | 0 .00 RPM | 48 .40 RPM |
SRP030211_testis | 0 .00 RPM | 32 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000010009 | 1 retrocopy |
retro_btau_1441 ,
|
Canis familiaris | ENSCAFG00000013472 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000009382 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000011045 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001335 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008441 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016602 | 1 retrocopy |