RetrogeneDB ID: | retro_btau_371 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 10:37115368..37115818(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNAP23 | ||
| Ensembl ID: | ENSBTAG00000005661 | ||
| Aliases: | None | ||
| Description: | synaptosomal-associated protein 23 [Source:RefSeq peptide;Acc:NP_001069299] |
| Percent Identity: | 76.32 % |
| Parental protein coverage: | 70.62 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | NEDMREAEKTLTELNKCCGLCVCPCSRTKNFESSKAYKATWGDGGDNSPSN-IVSKQPGRVTNGQPQQAT |
| N.DMREAEK.LTE.NK..G.C.CPC.RTKN.ES.K.YKATWGD.GD.SPSN.IVSKQPG.VTNGQ..Q.T | |
| Retrocopy | NKDMREAEKILTEFNKD*GRCLCPCNRTKNIESGKVYKATWGDAGDSSPSNVIVSKQPG*VTNGQLRQVT |
| Parental | AGAA-SGGYIKRITNDAREDEMEDNLTQVGSILGNL-KNMALDMGNEIEAQNRQIERITEKADTNKDRID |
| .GAA..G.YIK.ITN.AREDE.E.NLTQV.SIL.NL.KNMALD.GN.IEA.N.QIE.ITEKADTNKD.ID | |
| Retrocopy | TGAA>TGEYIKHITNHAREDETEENLTQVASILDNL<KNMALDIGNGIEAHN*QIEQITEKADTNKDHID |
| Parental | NANARAKKLIDS |
| NANARAKKL.DS | |
| Retrocopy | NANARAKKLTDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 42 .46 RPM |
| ERP005899_muscle | 0 .00 RPM | 36 .69 RPM |
| SRP017611_brain | 0 .00 RPM | 8 .59 RPM |
| SRP017611_kidney | 0 .00 RPM | 70 .47 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .59 RPM |
| SRP030211_testis | 0 .04 RPM | 13 .99 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015685 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000015774 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005661 | 2 retrocopies |
retro_btau_1622, retro_btau_371 ,
|
| Canis familiaris | ENSCAFG00000011105 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000006468 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000003638 | 1 retrocopy | |
| Felis catus | ENSFCAG00000013387 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000005462 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000813 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000017889 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000009856 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000027287 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050552 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006589 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002561 | 1 retrocopy |