RetrogeneDB ID: | retro_cfam_1279 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 28:15703821..15704007(-) | ||
Located in intron of: | ENSCAFG00000010380 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LYRM7 | ||
Ensembl ID: | ENSCAFG00000000736 | ||
Aliases: | None | ||
Description: | LYR motif containing 7 [Source:HGNC Symbol;Acc:28072] |
Percent Identity: | 100. % |
Parental protein coverage: | 62. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL |
QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL | |
Retrocopy | QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .67 RPM | 3 .61 RPM |
SRP017611_brain | 0 .32 RPM | 3 .18 RPM |
SRP017611_kidney | 2 .58 RPM | 11 .42 RPM |
SRP017611_liver | 0 .00 RPM | 0 .58 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017776 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000000736 | 1 retrocopy |
retro_cfam_1279 ,
|
Choloepus hoffmanni | ENSCHOG00000006766 | 6 retrocopies | |
Echinops telfairi | ENSETEG00000010130 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000166 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015568 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000045961 | 1 retrocopy |