RetrogeneDB ID: | retro_chof_2015 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_4556:19265..19490(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LYRM7 | ||
| Ensembl ID: | ENSCHOG00000006766 | ||
| Aliases: | None | ||
| Description: | LYR motif containing 7 [Source:HGNC Symbol;Acc:28072] |
| Percent Identity: | 94.67 % |
| Parental protein coverage: | 76.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VLQLFKTLHRTRQQVFKNDTRTLEAARIKINEEFKNNKSETSPKKIEELMKIGSDVELFLRTSVIQGVHT |
| VLQLF.TL.RTRQQVFKNDTR.LEAARIKINEEFKNNKSETSPKKIEELMKIGSDVELFLRTSVI.GVHT | |
| Retrocopy | VLQLFNTLQRTRQQVFKNDTRALEAARIKINEEFKNNKSETSPKKIEELMKIGSDVELFLRTSVILGVHT |
| Parental | DHNTL |
| DHNTL | |
| Retrocopy | DHNTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017776 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000736 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000006766 | 6 retrocopies |
retro_chof_1440, retro_chof_2015 , retro_chof_2366, retro_chof_2681, retro_chof_488, retro_chof_688,
|
| Echinops telfairi | ENSETEG00000010130 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000166 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015568 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000045961 | 1 retrocopy |