RetrogeneDB ID: | retro_cfam_557 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 13:51156007..51156237(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FIS1 | ||
Ensembl ID: | ENSCAFG00000013800 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.63 % |
Parental protein coverage: | 53.95 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | RDYVFYLAVGNYRLKEY-EKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGL |
.D.VF.LAVG...LKEY....LKYVRGLL.T.P.N.QA.ELE.LI.KA..K...VG....G..A.G.AGL | |
Retrocopy | KDLVFFLAVGSDLLKEY<QDTLKYVRGLL*TQPLNIQAEELEWLINKAVRKMETVGDMTLG--ARGLAGL |
Parental | AGLIGLAVSKSKS |
.GL...AVSK.K. | |
Retrocopy | TGL---AVSKCKT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 64 .72 RPM |
SRP017611_brain | 0 .00 RPM | 49 .78 RPM |
SRP017611_kidney | 0 .00 RPM | 150 .76 RPM |
SRP017611_liver | 0 .00 RPM | 39 .74 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000013800 | 2 retrocopies |
retro_cfam_557 , retro_cfam_755,
|
Callithrix jacchus | ENSCJAG00000016053 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000020494 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000024207 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000005034 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028158 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000001420 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000027757 | 1 retrocopy |