RetrogeneDB ID: | retro_cjac_1913 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:62247502..62247818(-) | ||
| Located in intron of: | ENSCJAG00000007106 | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000031858 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FIS1 | ||
| Ensembl ID: | ENSCJAG00000016053 | ||
| Aliases: | None | ||
| Description: | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:21689] |
| Percent Identity: | 59.43 % |
| Parental protein coverage: | 69.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LVRSKYNDDILKGVALLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPENNQAKELE |
| L....YNDDI.KG..LLEELLPKG.KEE..DYVFYL.VGNY.LK.YEKALKY...LLQTEP.N..AKELE | |
| Retrocopy | LMLTNYNDDICKGIKLLEELLPKGNKEEKQDYVFYLTVGNYQLKKYEKALKYIQELLQTEPQNTKAKELE |
| Parental | -RLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLA |
| .R...K.MKKD.LV................G..GLA | |
| Retrocopy | >RFTGKVMKKDKLVXXXXXXXXXXXXXXXLGVAGLA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .27 RPM | 8 .59 RPM |
| SRP051959_heart | 0 .18 RPM | 18 .72 RPM |
| SRP051959_kidney | 0 .22 RPM | 22 .16 RPM |
| SRP051959_liver | 0 .06 RPM | 21 .96 RPM |
| SRP051959_lung | 0 .37 RPM | 15 .86 RPM |
| SRP051959_lymph_node | 0 .32 RPM | 7 .76 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 43 .83 RPM |
| SRP051959_spleen | 0 .23 RPM | 11 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013800 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016053 | 1 retrocopy |
retro_cjac_1913 ,
|
| Loxodonta africana | ENSLAFG00000020494 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000024207 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000005034 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028158 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001420 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000027757 | 1 retrocopy |