RetrogeneDB ID: | retro_chof_1818 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_392166:8..434(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NECAP1 | ||
Ensembl ID: | ENSCHOG00000008087 | ||
Aliases: | None | ||
Description: | NECAP endocytosis associated 1 [Source:HGNC Symbol;Acc:24539] |
Percent Identity: | 78.87 % |
Parental protein coverage: | 51.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NVSLQDHFKWVKQESEISKESQEMDTRPKLDLGFKEGQTIKLSIGNITTKKGGASKPRTSGAGGLSLLPP |
.V.LQD.FKWVKQESEISKE..EMDT.PKLDLGFK.GQTIKLS.GNITTKKGGASKPRTSGAGGL.LL.P | |
Retrocopy | DVALQDYFKWVKQESEISKECLEMDTHPKLDLGFKGGQTIKLSNGNITTKKGGASKPRTSGAGGLTLLLP |
Parental | PPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTPATAPVTAGNYLCGDFTTAS |
..GG.VTI..PS.SVAISNHVTP.P.PKSN.G.SDADIL.DLD.PAPVTTPA.APV.AGN.L.GD..T.S | |
Retrocopy | QLGGTVTISYPSPSVAISNHVTPAPTPKSNQGDSDADILSDLDFPAPVTTPARAPVSAGNDLYGDLSTVS |
Parental | NS |
.S | |
Retrocopy | SS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016989 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000013930 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000008087 | 3 retrocopies |
retro_chof_1692, retro_chof_1818 , retro_chof_1913,
|
Dasypus novemcinctus | ENSDNOG00000014778 | 2 retrocopies | |
Homo sapiens | ENSG00000089818 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010233 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002979 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016742 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001743 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004309 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006358 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004238 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000023277 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000009236 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010153 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000014260 | 1 retrocopy |